PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.010G215700.1.p
Common NameSb10g026200, SORBIDRAFT_10g026200
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family SBP
Protein Properties Length: 445aa    MW: 47129.6 Da    PI: 9.1554
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.010G215700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP130.18.1e-41194270177
                           --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
                   SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                           +Cq+egC+adls ak+yhrrhkvCe h+ka+vv++ g++qrfCqqCsrfh lsefDe krsCr+rLa+hn+rrrk++
  Sobic.010G215700.1.p 194 RCQAEGCKADLSGAKHYHRRHKVCEYHAKASVVAAGGKQQRFCQQCSRFHVLSEFDEVKRSCRKRLAEHNRRRRKPA 270
                           6**************************************************************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.4E-34187256IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.359192269IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.62E-38193272IPR004333Transcription factor, SBP-box
PfamPF031107.0E-31195268IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009554Biological Processmegasporogenesis
GO:0009556Biological Processmicrosporogenesis
GO:0048653Biological Processanther development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 445 aa     Download sequence    Send to blast
MMSGRLNVAT SASPGDDFPF ASMQQQQQPP PPPPPPPYVG FEHGVAGGGG GQRGAGGMGM  60
QQQQHLYDGL DFAAALQFQQ EAPHHHHHQL LTLPSSLGPM APPPLPMPMP MPLQMPMPMP  120
GMPGGDHVYQ ALGMVKREGG GGGGADAGRI GLNLGRRTYF SPGDMLAVDR LLMRSRLGGV  180
FGLGFGGAHH QPPRCQAEGC KADLSGAKHY HRRHKVCEYH AKASVVAAGG KQQRFCQQCS  240
RFHVLSEFDE VKRSCRKRLA EHNRRRRKPA TTASSKDAAS PPANKKPNGG SITSSYSTDN  300
KNLSTAKSTM SSNTSSVISC LDQAGNKQQQ LARPTLTLGA SQDNKDQHQH QQQLSTMLQV  360
QAAGGGHHQE QHFLTSLQVH NNGGCGGGNN NNILSCSSVC SSGALPSSAN GEVSDQNTTT  420
TTTNNGNGGS SNNNLHNLFE VDFM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A8e-291952681184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1251268KRSCRKRLAEHNRRRRKP
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00090SELEXTransfer from AT1G02065Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0339370.0BT033937.1 Zea mays full-length cDNA clone ZM_BFc0033O21 mRNA, complete cds.
GenBankBT0342980.0BT034298.1 Zea mays full-length cDNA clone ZM_BFc0007A11 mRNA, complete cds.
GenBankBT0657120.0BT065712.1 Zea mays full-length cDNA clone ZM_BFc0041B17 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002437398.10.0hypothetical protein SORBIDRAFT_10g026200
SwissprotA2YFT91e-108SPL10_ORYSI; Squamosa promoter-binding-like protein 10
SwissprotQ0DAE81e-108SPL10_ORYSJ; Squamosa promoter-binding-like protein 10
TrEMBLC5Z7900.0C5Z790_SORBI; Putative uncharacterized protein Sb10g026200
STRINGSb10g026200.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23753593
Representative plantOGRP9717230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G02065.13e-48squamosa promoter binding protein-like 8